PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10039_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 639aa    MW: 71529.9 Da    PI: 5.9946
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10039_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-094334701954
                                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           Fe   ++yp+ +e+  LA+++gL+ +qV +WF N R +
  cra_locus_10039_iso_3_len_2645_ver_3 433 FEHflHPYPKDSEKIMLARQTGLSRSQVANWFINARVR 470
                                           664459******************************88 PP

2BELL112.42.4e-36300371172
                                  BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                           er++lq+k +kLls+l+eVd+rY+qy++q+q+v+ssFe+vag g+a+ Yt+lAl++iS +FrcL+dai++qi
  cra_locus_10039_iso_3_len_2645_ver_3 300 ERNDLQNKMTKLLSMLNEVDRRYRQYNQQMQVVASSFEIVAGRGAARRYTALALRTISCQFRCLRDAIKKQI 371
                                           7899*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-46224369IPR006563POX domain
PfamPF075261.9E-44227367IPR006563POX domain
PROSITE profilePS5007112.276411474IPR001356Homeobox domain
SMARTSM003894.4E-10414478IPR001356Homeobox domain
CDDcd000862.23E-12414475No hitNo description
SuperFamilySSF466891.33E-17415481IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-28417480IPR009057Homeodomain-like
PfamPF059201.3E-17431470IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MSTYFSNLTS QGDVMQTQYL LNSKLTPYQS SDLPHDMMYM NAPSSAAASH PQLFPASSLP  60
GHIYIEAQSV DSREEMLFMA PSGSPMIMQP MDRQLDIASS FSDSNAAMMD PQAFAKNLLH  120
VQNADLNLQP QGLSLSLGNQ VHQLPSYHNP YTNSGVSSLM NPQVEHSDEH GSQSGELRKV  180
EYLSFDLAGR SNDNIKIGSL NNPQPSITPK AINSDSKLHE GTVVGGMLHN SKYLQEVQEL  240
LDEVVNVHQD LKQQEKHHEF QPFGHDASEE IKLKSNCQSG MSSDPQKSVG ISSDDLSPAE  300
RNDLQNKMTK LLSMLNEVDR RYRQYNQQMQ VVASSFEIVA GRGAARRYTA LALRTISCQF  360
RCLRDAIKKQ IQAVQQSLGE HSTMPNGFTR LRYVDQQLRQ QRNLQQFGML RQPWRPQRGL  420
PETAVSILRA WLFEHFLHPY PKDSEKIMLA RQTGLSRSQV ANWFINARVR LWKPMIEEMY  480
KEEFGDIEGD SKSSELAQAV ARLKSESEDA AGEELHESSI SATADANQLR QSKKLSSQDG  540
SYEENAMNSE SNKSWRNKIV NQTDDQSITA SIKPYEFSML GGTRVSLALG LQHSETNPQS  600
GIDGTAASVG VDKADYFCID AINQQDRFSN PHLLSDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16420478563Homeobox protein Meis2
3k2a_B2e-16420478563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083616.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083614.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083613.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_015161897.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_006341980.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLA0A068UFX50.0A0A068UFX5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022